DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and AT5G23840

DIOPT Version :10

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_197773.1 Gene:AT5G23840 / 832449 AraportID:AT5G23840 Length:167 Species:Arabidopsis thaliana


Alignment Length:123 Identity:24/123 - (19%)
Similarity:47/123 - (38%) Gaps:28/123 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVVFAGALEFSDC---GSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVV 73
            |.....|::|..|   |...|..:::.:...|..      :.|.|::..: |..|.:..:..|:|
plant    19 LPALCSAIDFEYCTKNGHDYGSISQIWVSPSDGP------QENPTITIHL-FGSASKDISAGTLV 76

  Fly    74 H-----GKVLGIEMPFPL-----ANPDACVDSGLKCPLEK--------DESYRYTATL 113
            :     |...|:...:.|     .||:..:::|....|..        ||..:|:.:|
plant    77 YVTYRSGDFTGLLKTYDLCDVSACNPEYVIEAGTDFELTLSDVLYVGFDEEIKYSVSL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 22/114 (19%)
AT5G23840NP_197773.1 ML 28..154 CDD:469700 22/114 (19%)

Return to query results.
Submit another query.