DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and AT3G11780

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001189862.1 Gene:AT3G11780 / 820352 AraportID:AT3G11780 Length:171 Species:Arabidopsis thaliana


Alignment Length:63 Identity:16/63 - (25%)
Similarity:24/63 - (38%) Gaps:21/63 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SFSIDFALAEEATAVKTVVH---------GKVLGIEM-PFPL-----------ANPDACVDSG 96
            |.:|.:.|........|.||         .||.|::: |:|:           ||.|..:.||
plant     9 SLAISYFLLVSTIVAATDVHYCDNNEEYEVKVQGVDITPYPIARGEPATFRISANTDTEISSG 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 16/63 (25%)
AT3G11780NP_001189862.1 PG-PI_TP 27..160 CDD:238459 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.