powered by:
Protein Alignment Npc2a and AT3G11780
DIOPT Version :9
Sequence 1: | NP_608637.1 |
Gene: | Npc2a / 33374 |
FlyBaseID: | FBgn0031381 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189862.1 |
Gene: | AT3G11780 / 820352 |
AraportID: | AT3G11780 |
Length: | 171 |
Species: | Arabidopsis thaliana |
Alignment Length: | 63 |
Identity: | 16/63 - (25%) |
Similarity: | 24/63 - (38%) |
Gaps: | 21/63 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 SFSIDFALAEEATAVKTVVH---------GKVLGIEM-PFPL-----------ANPDACVDSG 96
|.:|.:.|........|.|| .||.|::: |:|: ||.|..:.||
plant 9 SLAISYFLLVSTIVAATDVHYCDNNEEYEVKVQGVDITPYPIARGEPATFRISANTDTEISSG 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11306 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.