DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and Npc2

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 / 67963 MGIID:1915213 Length:149 Species:Mus musculus


Alignment Length:145 Identity:55/145 - (37%)
Similarity:79/145 - (54%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVIACAALVVFAGA--LEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEAT 67
            |.|...|||..:.|  |.|.|||||.|....|.:..|.|.  .|.|.:..:.|.:|.|....::.
Mouse     6 ATILLLALVAASQAEPLHFKDCGSKVGVIKEVNVSPCPTD--PCQLHKGQSYSVNITFTSGTQSQ 68

  Fly    68 AVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQD 132
            ....:|||.:.||.:|||:..||.| .||:.||::||:.|.|...|||...||.:.::|:|:|:|
Mouse    69 NSTALVHGILEGIRVPFPIPEPDGC-KSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLED 132

  Fly   133 QDGADIICVEIPAKI 147
            ....::.|.|||.:|
Mouse   133 DKKNNLFCWEIPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 46/123 (37%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 46/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839274
Domainoid 1 1.000 102 1.000 Domainoid score I6857
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4697
Inparanoid 1 1.050 104 1.000 Inparanoid score I4937
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49115
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007859
OrthoInspector 1 1.000 - - oto93625
orthoMCL 1 0.900 - - OOG6_106086
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4693
SonicParanoid 1 1.000 - - X5814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.