DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and npc2.2

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001122191.1 Gene:npc2.2 / 565099 ZFINID:ZDB-GENE-080723-11 Length:149 Species:Danio rerio


Alignment Length:148 Identity:50/148 - (33%)
Similarity:79/148 - (53%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YAVIACAAL----VVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAE 64
            |.|:|...|    ...|..::|.||||..||..:|.|:.|  ::..|.|.:..:.:.::.|..:.
Zfish     3 YRVLAVILLSFLAYTCADPVKFVDCGSVHGKVVQVDIKPC--SQQPCQLHKGQSYTVNVTFISSV 65

  Fly    65 EATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWE 129
            .:...|.||||.|..:.:|||:...|.| .||::||:...:.|.|...|||...||.:.|:|:||
Zfish    66 ASQTSKAVVHGVVECVPVPFPIPIDDGC-KSGIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWE 129

  Fly   130 LQDQDGADIICVEIPAKI 147
            |:|....|:.|::.|.:|
Zfish   130 LRDDSSKDLFCIKFPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 43/123 (35%)
npc2.2NP_001122191.1 Npc2_like 24..145 CDD:238458 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583275
Domainoid 1 1.000 101 1.000 Domainoid score I6909
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4697
Inparanoid 1 1.050 102 1.000 Inparanoid score I4963
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 1 1.000 - - FOG0007859
OrthoInspector 1 1.000 - - otm24240
orthoMCL 1 0.900 - - OOG6_106086
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5814
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.