DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and npc2

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_012823720.1 Gene:npc2 / 493351 XenbaseID:XB-GENE-6258064 Length:156 Species:Xenopus tropicalis


Alignment Length:129 Identity:46/129 - (35%)
Similarity:74/129 - (57%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGIEMP 83
            |::.||||::||...:.:..|  .:..|.|.|.:|.:.:..|.....:.:...||||.:.||.:|
 Frog    28 LKYKDCGSQSGKLVTLDVSPC--PEEPCPLVRGSTYTVNATFVSNVNSKSASAVVHGIIAGIAVP 90

  Fly    84 FPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKI 147
            ||::.||.| .||:.||:...::|.|...||:...||.:.::|||:|||::..|:.|..||..|
 Frog    91 FPISEPDGC-KSGISCPINSGQTYTYVTKLPIKSEYPCIKLVVKWQLQDENNKDLFCWLIPVHI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 43/123 (35%)
npc2XP_012823720.1 Npc2_like 30..151 CDD:238458 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4697
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.