DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and Npc2c

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster


Alignment Length:106 Identity:31/106 - (29%)
Similarity:45/106 - (42%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VAIEGCDTTKAECILKRNTTVSFSIDF-ALAEEATAVKTVVHGKVLGIEMPFPL--ANPDACVD- 94
            |.|:.||.  ..|.|.:.|.....|.| |.......:...||...||:.:|:.|  :..:.|.: 
  Fly    40 VQIDDCDA--LPCDLWKGTEAKIDIQFVATRNTMKKLSAEVHLTSLGVTIPYDLEASRGNVCSNL 102

  Fly    95 -SGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQD 134
             .|..|||:..|...|...|||..:.|:|...::..|.|.|
  Fly   103 LHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLEVRLLDSD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 31/106 (29%)
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 31/106 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.