DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and Npc2d

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster


Alignment Length:119 Identity:37/119 - (31%)
Similarity:53/119 - (44%) Gaps:8/119 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGI-----EMPFPLANPDACV 93
            |.:..|.|  ..|.:.:.||..|.||||:.:..|.:.|:|....|||     |:|..:|.....:
  Fly    42 VRVHNCVT--PPCQIVKGTTQKFEIDFAVDKYITQLTTLVKATTLGIITVPYELPADVAAVCPNL 104

  Fly    94 DSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKI 147
            ..|..|||...|...|..|.|: ..||::.|.::..|.|||.....|.....|:
  Fly   105 QYGAYCPLYPTEDVSYLFTFPI-GEYPEIGVKIEIYLVDQDNEIATCFVCDIKV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 36/115 (31%)
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.