DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and npc2.1

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_775331.1 Gene:npc2.1 / 282673 ZFINID:ZDB-GENE-021206-13 Length:149 Species:Danio rerio


Alignment Length:147 Identity:49/147 - (33%)
Similarity:80/147 - (54%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEE 65
            :|.:....|      |..::|.||||..||..:|.|:.|  ::..|.|.:..:.:.::.|:...|
Zfish    10 LLSFLAYTC------ADPVKFVDCGSVDGKVVQVDIKPC--SQQPCKLHKGQSYTVNVTFSSGVE 66

  Fly    66 ATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWEL 130
            :...|.||||.:.|:.:|||:...|.| .||::||:...:.|.|...|||...||.:.|:|:|||
Zfish    67 SQTSKAVVHGVLAGVPVPFPIPIDDGC-KSGIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWEL 130

  Fly   131 QDQDGADIICVEIPAKI 147
            :|....|:.|::.|.:|
Zfish   131 RDDSSKDLFCIKFPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 44/123 (36%)
npc2.1NP_775331.1 Npc2_like 24..145 CDD:238458 44/123 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583274
Domainoid 1 1.000 101 1.000 Domainoid score I6909
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4697
Inparanoid 1 1.050 102 1.000 Inparanoid score I4963
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 1 1.000 - - FOG0007859
OrthoInspector 1 1.000 - - otm24240
orthoMCL 1 0.900 - - OOG6_106086
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4693
SonicParanoid 1 1.000 - - X5814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.