DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2a and heh-1

DIOPT Version :9

Sequence 1:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001379800.1 Gene:heh-1 / 175426 WormBaseID:WBGene00006452 Length:154 Species:Caenorhabditis elegans


Alignment Length:148 Identity:45/148 - (30%)
Similarity:73/148 - (49%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALVVFAGALEFSDCGSKT----GKFTRVAIEGCDTT----KAECILKRNTTVSFSIDFALAEEAT 67
            ||:..|.| ||.:.|.|.    |..::|..:||:.|    |..|:.|:.:.....|.|..:::..
 Worm     8 ALLGLAAA-EFIEIGYKVCKSDGTVSQVKADGCELTVKDGKKVCLFKKGSRPIIQIAFKPSKDTD 71

  Fly    68 AVKTVVHGKVLGIEM-PFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVL-VKWEL 130
            .:||.|..||.|..| .||..|.|||. .|:|||:...|:..:..::.:..::|...|: |.|:|
 Worm    72 KLKTSVRAKVGGSAMVDFPQTNSDACT-YGVKCPVSAGENQIFEQSISITENHPAGEVIQVNWQL 135

  Fly   131 QDQDGADIICVEIPAKIQ 148
            ...|....:|:...|:|:
 Worm   136 TRPDSGKEVCIIFLAEIK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 38/133 (29%)
heh-1NP_001379800.1 Npc2_like 22..150 CDD:238458 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I7325
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I3978
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto18881
orthoMCL 1 0.900 - - OOG6_106086
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.