DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Got2 and ASP5

DIOPT Version :9

Sequence 1:NP_722745.1 Gene:Got2 / 33373 FlyBaseID:FBgn0001125 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001031767.1 Gene:ASP5 / 829330 AraportID:AT4G31990 Length:462 Species:Arabidopsis thaliana


Alignment Length:394 Identity:188/394 - (47%)
Similarity:263/394 - (66%) Gaps:2/394 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FSEVQMGPPDAILGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVSRSLDKEYA 98
            |..:.|.|||.||||:||||.|||..|:|||.||||.:..||:||..|::||..::.|..:|||.
plant    53 FEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNKEYL 117

  Fly    99 TIIGIPEFYNKAIELALGKGSKRLAAKHNVTAQSISGTGALRIGAAFLAKFWQGNREIYIPSPSW 163
            .|.|:..|.....||..|.|...:..:...|.|.:||||:||:.||.:.:::.| .::.|.||:|
plant   118 PIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPG-AKVVISSPTW 181

  Fly   164 GNHVAIFEHAGLPVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGVDPTLEQWR 228
            |||..||..|.:|.:.|||||..|..|||.|:|.|:|:.||.|.:|||.|||||||:|||.|||.
plant   182 GNHKNIFNDAKVPWSEYRYYDPKTIGLDFEGMIADIKEAPEGSFILLHGCAHNPTGIDPTPEQWV 246

  Fly   229 EISALVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFT 293
            :|:.:::::|..||.|:||||||:|.:|.||.:||.|...|.:|.:|||::||:|||.||.||..
plant   247 KIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAIN 311

  Fly   294 VLCSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDVRTK 358
            |:||..:.|.||.||:|.:.|.:|||||||||||.|.::.:..:.::|..::::||.||..||.:
plant   312 VVCSSADAATRVKSQLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQE 376

  Fly   359 LKDNLI-KLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVTSKNVEYL 422
            |.|:|: |..|.::|..|:.|||||.||||...|...:.....||:|.|||:|:||::....|||
plant   377 LYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYL 441

  Fly   423 AESI 426
            |::|
plant   442 ADAI 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Got2NP_722745.1 AAT_I 21..431 CDD:302748 188/394 (48%)
Aminotran_1_2 58..426 CDD:278580 171/368 (46%)
ASP5NP_001031767.1 PLN02397 30..452 CDD:215222 188/394 (48%)
Aminotran_1_2 79..445 CDD:278580 171/366 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1448
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62835
OrthoDB 1 1.010 - - D1104596at2759
OrthoFinder 1 1.000 - - FOG0000707
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100337
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.