DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Got2 and got1l1

DIOPT Version :9

Sequence 1:NP_722745.1 Gene:Got2 / 33373 FlyBaseID:FBgn0001125 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001116776.1 Gene:got1l1 / 791730 ZFINID:ZDB-GENE-060929-556 Length:423 Species:Danio rerio


Alignment Length:391 Identity:139/391 - (35%)
Similarity:224/391 - (57%) Gaps:12/391 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVS-RSLDKEYATIIGIPEFYNK 109
            |.:.|.||:||.|.|:||....|..:......||.||:.:.::.: .:|:.||..|:|||||..:
Zfish    31 LKIIEDFKRDTYPDKVNLAGREYVGEQGHTTWLPLVRKIKLQIATDPTLNPEYPPILGIPEFTRR 95

  Fly   110 AIELALGKGSKRLAAKHNVTAQSISGTGALRIGAAFLAKF------WQGNREIYIPSPSWGNHVA 168
            |.||||||.|..:........|:|..|||:|:||..|..:      |.|  .|.:||....:...
Zfish    96 ATELALGKDSPAIIESRVFGIQTIGYTGAVRLGAELLRSWYCSNSPWSG--PILLPSSCDDSLTD 158

  Fly   169 IFEHAGL-PVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGVDPTLEQWREISA 232
            .|:.||: .|.:|||...|:..|....:::||:..||..:|:|....|||||.:.:.|.|:.::.
Zfish   159 TFKAAGIDDVQQYRYGSADSNGLCVENMVQDLENTPEHCVVVLFVSGHNPTGAELSQEDWKRVAD 223

  Fly   233 LVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVLCS 297
            ::.:|.|:||..|:.||..:|.:::||..:....:.|.:...||||:.|.||||||.|  .:||.
Zfish   224 VMVRRKLFPFFLMSAQGLCSGSLEQDAWPLHHCVSLGLELLCAQSFSHNFGLYGERVG--HLLCV 286

  Fly   298 DEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDVRTKLKDN 362
            .::....|.||.:.:::.|:|.||:.|||:.|.||:|.....:|.:.||.||:|.:.:|.:|::.
Zfish   287 LKQNVLAVQSQAEKMVQTLWSCPPMEGARVVATILSNPAHLVEWQESVKAMAERCMLIRERLRER 351

  Fly   363 LIKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVTSKNVEYLAESIH 427
            |..||....||.|:...|::|..||..:||:.|::...:||..:|..:::.:.|:|::|:|||||
Zfish   352 LRLLGVPGCWDRILKPGGLYCCFGLNVQQVEFLVQKKHIYLLPNGCFNISAINSRNLDYVAESIH 416

  Fly   428 K 428
            :
Zfish   417 Q 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Got2NP_722745.1 AAT_I 21..431 CDD:302748 139/391 (36%)
Aminotran_1_2 58..426 CDD:278580 130/375 (35%)
got1l1NP_001116776.1 AAT_I 31..419 CDD:302748 139/391 (36%)
Aminotran_1_2 43..415 CDD:278580 130/375 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1448
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1104596at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.