DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Got2 and Got1

DIOPT Version :9

Sequence 1:NP_722745.1 Gene:Got2 / 33373 FlyBaseID:FBgn0001125 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_034454.2 Gene:Got1 / 14718 MGIID:95791 Length:413 Species:Mus musculus


Alignment Length:407 Identity:191/407 - (46%)
Similarity:274/407 - (67%) Gaps:11/407 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FSEVQMGPPDAILGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVS-RSLDKEY 97
            |::|...||..:..:|..|:.|.:|:|:|||.||||.|.:||:|||.||:.|:::.: .||:.||
Mouse     7 FAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEY 71

  Fly    98 ATIIGIPEFYNKAIELALGKGSKRLAAKHNVT--AQSISGTGALRIGAAFLAKFWQG----NREI 156
            ..|:|:.||.:.|..|.||..|  ||.:.|..  .||:.|||||||||.||.:::.|    |..|
Mouse    72 LPILGLAEFRSCASRLVLGDNS--LAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPI 134

  Fly   157 YIPSPSWGNHVAIFEHAGL-PVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGV 220
            |:.||:|.||.|:|..||. .:..|.|:|.:...||..|.:.||:..||.||.:||||||||||.
Mouse   135 YVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGT 199

  Fly   221 DPTLEQWREISALVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLY 285
            |||.|||::|:|::::|.|:||.|.||||||:||:::||.|:|.|.::|.:...||||:||.|||
Mouse   200 DPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLY 264

  Fly   286 GERAGAFTVLCSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMAD 350
            .||.|..||:..:.:...||:||::.::|..:||||..||||.|..|::.:|..:|..:||.|||
Mouse   265 NERVGNLTVVGKESDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMAD 329

  Fly   351 RIIDVRTKLKDNLIKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVT 415
            ||:.:|::|:..|..|.:...|.||..|||||.||||.|:||:.|:.:..:||...||::|.|:|
Mouse   330 RILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLT 394

  Fly   416 SKNVEYLAESIHK-VTK 431
            :||::|:|.|||: |||
Mouse   395 TKNLDYVATSIHEAVTK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Got2NP_722745.1 AAT_I 21..431 CDD:302748 189/405 (47%)
Aminotran_1_2 58..426 CDD:278580 178/375 (47%)
Got1NP_034454.2 AAT_I 1..413 CDD:302748 191/407 (47%)
Aminotran_1_2 31..405 CDD:278580 178/375 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1448
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62835
OrthoDB 1 1.010 - - D1104596at2759
OrthoFinder 1 1.000 - - FOG0000707
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100337
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.