DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and HNT1

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_010158.1 Gene:HNT1 / 851432 SGDID:S000002283 Length:158 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:29/114 - (25%)
Similarity:41/114 - (35%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CFFCDFAHRRQGPPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSH----VGLVR 93
            |.||...  :...|....:||.....|.|..|.|..|.|.|||.|...|..:....    :.:.:
Yeast    25 CIFCKII--KSEIPSFKLIETKYSYAFLDIQPTAEGHALIIPKYHGAKLHDIPDEFLTDAMPIAK 87

  Fly    94 RMEQGMMEFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFG 142
            |:.:.|.  |.:.||......:...     .|.|:|.| :.|..|...|
Yeast    88 RLAKAMK--LDTYNVLQNNGKIAHQ-----EVDHVHFH-LIPKRDEKSG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 26/104 (25%)
HNT1NP_010158.1 HINT_subgroup 25..122 CDD:238608 26/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.