DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and HINT2

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_024303470.1 Gene:HINT2 / 84681 HGNCID:18344 Length:165 Species:Homo sapiens


Alignment Length:107 Identity:29/107 - (27%)
Similarity:47/107 - (43%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNK------SHVGLVRRM---EQGMM 100
            |..|| .|..:.::|:|..|.|.:|:|.|||:....:....:      .|:.||.:.   .:|:.
Human    67 PADIL-YEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLG 130

  Fly   101 EFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGI------FPP 136
            :..|....|.|   :|..     ||.|||:|.:      :||
Human   131 DGYRLVINDGK---LGAQ-----SVYHLHIHVLGGRQLQWPP 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 27/103 (26%)
HINT2XP_024303470.1 PKCI_related 55..157 CDD:238607 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.