DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and hint3

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001039146.1 Gene:hint3 / 733971 XenbaseID:XB-GENE-1000078 Length:153 Species:Xenopus tropicalis


Alignment Length:146 Identity:51/146 - (34%)
Similarity:82/146 - (56%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASGEVRQAESEKCFFCDFAHRRQGPPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALN 85
            |:.|...:....|.||..|::::....:|..: |:.|.|||..||...|||.:||:|..:.|.|.
 Frog     7 ATVEQNHSYDMSCIFCRIANKQESGAELLHSD-DDLVCFKDIRPAVTHHYLVVPKKHVGTCKTLT 70

  Fly    86 KSHVGLVRRMEQGMMEFLRSQNVDPKEAI-VGFHLPPFISVRHLHLHGIFPPADMSFGNKISF-M 148
            |.||.|::.|.:.....|:..||...|.| :|||.|||.|:.|||||.:.|.:.:.|.:::.: :
 Frog    71 KDHVQLIKTMMEVGKSTLQKNNVTDLEDIRLGFHYPPFCSISHLHLHVLAPASQLGFLSRMIYRV 135

  Fly   149 PSFWFKKSSDAIRELE 164
            .|:||..:.:.|.:|:
 Frog   136 NSYWFITADELIDQLQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 42/102 (41%)
hint3NP_001039146.1 HIT_like 18..120 CDD:381879 42/102 (41%)
Histidine triad motif 113..117 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6977
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12046
Inparanoid 1 1.050 114 1.000 Inparanoid score I4690
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - otm48900
Panther 1 1.100 - - O PTHR12486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.