DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and si:dkey-25e12.3

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001020726.2 Gene:si:dkey-25e12.3 / 678527 ZFINID:ZDB-GENE-041001-132 Length:160 Species:Danio rerio


Alignment Length:114 Identity:43/114 - (37%)
Similarity:65/114 - (57%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRQAESEKCFFCDFAHRRQGPPPILEV--ETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKS 87
            :.::..:.|.||..|   :|.....|:  |.:::|.|:|..|.|..|||.|||:|..|..:|...
Zfish    15 IDESLDKTCIFCTIA---KGDDRYTEILAEDEDFVCFRDINPGAPHHYLVIPKKHIYSCLSLYAD 76

  Fly    88 HVGLVRRMEQGMMEFLRSQNV-DPKEAIVGFHLPPFISVRHLHLHGIFP 135
            .:.|||.|.:.....|::.|| |.|:..:|||:||:|:|.|||||.:.|
Zfish    77 DISLVRGMAEMGRNVLKANNVTDLKDISLGFHVPPYITVPHLHLHVLAP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 42/104 (40%)
si:dkey-25e12.3NP_001020726.2 HIT_like 22..124 CDD:294158 42/104 (40%)
Histidine triad motif 117..121 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580847
Domainoid 1 1.000 94 1.000 Domainoid score I7416
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4886
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - mtm6404
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - O PTHR12486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.