DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and Hint3

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_006512886.1 Gene:Hint3 / 66847 MGIID:1914097 Length:200 Species:Mus musculus


Alignment Length:158 Identity:48/158 - (30%)
Similarity:70/158 - (44%) Gaps:37/158 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CFFCDFAHRRQGPPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHV-------- 89
            |.||..|..::....:...|.::.|.|||..|||..|||.:||:|..|.|.|||.|:        
Mouse    31 CVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVYSRSV 95

  Fly    90 ----------------GLVRRMEQ------------GMMEFLRSQNVDPKEAIVGFHLPPFISVR 126
                            |.::|:.:            |.....|:...|..:..:|||:|||.|:.
Mouse    96 LVAVFTRVWVSLAVLYGTLQRINETRLFRVESMVAAGKTMLERNNFTDFTDVRMGFHVPPFCSIS 160

  Fly   127 HLHLHGIFPPADMSFGNKISF-MPSFWF 153
            |||||.|.|..:..|.:|:.: ..|:||
Mouse   161 HLHLHVIAPVKEFGFLSKLVYRQDSYWF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 41/136 (30%)
Hint3XP_006512886.1 aprataxin_related 30..168 CDD:238609 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837247
Domainoid 1 1.000 106 1.000 Domainoid score I6584
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12046
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49262
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - otm43730
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - O PTHR12486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.710

Return to query results.
Submit another query.