DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and NitFhit

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster


Alignment Length:204 Identity:39/204 - (19%)
Similarity:62/204 - (30%) Gaps:73/204 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLAGLGLIVLVSIYKCASGEVRQAESEKCFFCDFAHRRQGPPPILEVETDEYVI----FKDKYPA 65
            |.|.:.|.||.|:|          ::..|    |.|||          .|.|.:    .:.|.|.
  Fly   273 GTAEVDLSVLQSLY----------QTMPC----FEHRR----------NDIYALTAYNLRSKEPT 313

  Fly    66 ARLHY---------LAIPKEH---FDSLKALNKSH--------------------------VGLV 92
            ....:         :....||   |.:|:.:.|.|                          |.||
  Fly   314 QDRPFATNIVDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLV 378

  Fly    93 RRMEQGMMEFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFGNKISFMPSFWFKKSS 157
            :|:.:.:.:...:.......|..|..:|      |:|.| |.|.....||:..........:...
  Fly   379 QRLLEKIYQTTSATVTVQDGAQAGQTVP------HVHFH-IMPRRLGDFGHNDQIYVKLDERAEE 436

  Fly   158 DAIRELEDR 166
            ...|.:|:|
  Fly   437 KPPRTIEER 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 25/143 (17%)
NitFhitNP_525122.1 nit 34..296 CDD:143596 10/36 (28%)
FHIT 317..436 CDD:238606 20/125 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.