Sequence 1: | NP_608634.1 | Gene: | CG15362 / 33371 | FlyBaseID: | FBgn0031378 | Length: | 168 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_525122.1 | Gene: | NitFhit / 38029 | FlyBaseID: | FBgn0024945 | Length: | 460 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 39/204 - (19%) |
---|---|---|---|
Similarity: | 62/204 - (30%) | Gaps: | 73/204 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 GLAGLGLIVLVSIYKCASGEVRQAESEKCFFCDFAHRRQGPPPILEVETDEYVI----FKDKYPA 65
Fly 66 ARLHY---------LAIPKEH---FDSLKALNKSH--------------------------VGLV 92
Fly 93 RRMEQGMMEFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFGNKISFMPSFWFKKSS 157
Fly 158 DAIRELEDR 166 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15362 | NP_608634.1 | aprataxin_related | 32..134 | CDD:238609 | 25/143 (17%) |
NitFhit | NP_525122.1 | nit | 34..296 | CDD:143596 | 10/36 (28%) |
FHIT | 317..436 | CDD:238606 | 20/125 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0537 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |