DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and HINT1

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_005331.1 Gene:HINT1 / 3094 HGNCID:4912 Length:126 Species:Homo sapiens


Alignment Length:108 Identity:27/108 - (25%)
Similarity:43/108 - (39%) Gaps:18/108 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RRQGPPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNK------SHVGLVRRMEQGM 99
            |::.|..|: .|.|..:.|.|..|.|..|:|.|||:|...:.....      .|:.:|.:.....
Human    24 RKEIPAKII-FEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD 87

  Fly   100 MEFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGI------FPP 136
            :...:...:...|...|..     ||.|:|||.:      :||
Human    88 LGLNKGYRMVVNEGSDGGQ-----SVYHVHLHVLGGRQMHWPP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 25/104 (24%)
HINT1NP_005331.1 PKCI_related 16..118 CDD:238607 25/99 (25%)
Histidine triad motif 110..114 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.