DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and SPCC1442.14c

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_588328.1 Gene:SPCC1442.14c / 2538824 PomBaseID:SPCC1442.14c Length:133 Species:Schizosaccharomyces pombe


Alignment Length:124 Identity:31/124 - (25%)
Similarity:54/124 - (43%) Gaps:17/124 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CFFCDFAHRRQGPPPILEV-ETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSH----VGLV 92
            |.||...   :|..|.::: ||...:.|.|..|.::.|.|.|||||...:..|:...    :.||
pombe     3 CIFCKIV---KGDIPCVKLAETALSLAFLDIAPTSKGHALVIPKEHAAKMHELSDESCADILPLV 64

  Fly    93 RRMEQGMMEFLRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFGNKISFMPSF 151
            :::.:.:..  .:.||......:....     |.|:|.| |.|..:..:|..:.: ||:
pombe    65 KKVTKAIGP--ENYNVLQNNGRIAHQF-----VDHVHFH-IIPKPNEEYGLGVGW-PSY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 26/105 (25%)
SPCC1442.14cNP_588328.1 HINT_subgroup 2..100 CDD:238608 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.