DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and hint-3

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001256089.1 Gene:hint-3 / 182943 WormBaseID:WBGene00016150 Length:200 Species:Caenorhabditis elegans


Alignment Length:142 Identity:48/142 - (33%)
Similarity:72/142 - (50%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CFFCDFAHRRQGPPPILEV-ETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRME 96
            |.|||....::.    |:: |....|:..|..|.|:.|||.:.|:|......|..:.|.|:..||
 Worm    36 CKFCDIVKNKKE----LQLKENKSCVVINDIKPKAKNHYLVLSKQHIAKPTDLTVADVPLLEEME 96

  Fly    97 QGMMEFLRSQ-----NVDPKEAI--VGFHLPPFISVRHLHLHGIFPPADMS-FGNKISFMPSFWF 153
            :...|.||..     ..|..|.:  :||||||.:||.|||:|.|:|.:||. ...|::|.|...|
 Worm    97 KTGRELLREHLKKKGEADTVEDMLRIGFHLPPLLSVHHLHMHIIYPISDMGLISRKLTFRPGKVF 161

  Fly   154 KKSSDAIRELED 165
            |.:.:.|.:|::
 Worm   162 KPARELIDQLKE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 37/108 (34%)
hint-3NP_001256089.1 aprataxin_related 35..141 CDD:238609 37/108 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159432
Domainoid 1 1.000 72 1.000 Domainoid score I6074
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I3794
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49262
OrthoDB 1 1.010 - - D1496385at2759
OrthoFinder 1 1.000 - - FOG0004937
OrthoInspector 1 1.000 - - otm14699
orthoMCL 1 0.900 - - OOG6_103575
Panther 1 1.100 - - O PTHR12486
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.