DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15362 and Fhit

DIOPT Version :9

Sequence 1:NP_608634.1 Gene:CG15362 / 33371 FlyBaseID:FBgn0031378 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001295214.1 Gene:Fhit / 14198 MGIID:1277947 Length:213 Species:Mus musculus


Alignment Length:148 Identity:30/148 - (20%)
Similarity:51/148 - (34%) Gaps:37/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KCFFCDFAHRRQG----PPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVG-- 90
            :.|:|:....|.|    .|.::.::|:......::.|....|.|..|....:..:.|:...|.  
Mouse    57 RSFYCETMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADL 121

  Fly    91 ---------LVRRMEQGMMEFLRSQNVDPKEAIVGFHLPPFISVRHLHLH------GIFPPAD-- 138
                     :|.:..||.......|  |..||        ..:|:|:|:|      |.||..|  
Mouse   122 FQVTQRVGTVVEKHFQGTSITFSMQ--DGPEA--------GQTVKHVHVHVLPRKAGDFPRNDNI 176

  Fly   139 ----MSFGNKISFMPSFW 152
                .....:....|:||
Mouse   177 YDELQKHDREEEDSPAFW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15362NP_608634.1 aprataxin_related 32..134 CDD:238609 24/122 (20%)
FhitNP_001295214.1 FHIT 68..187 CDD:238606 24/128 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.