DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG5504

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster


Alignment Length:375 Identity:109/375 - (29%)
Similarity:168/375 - (44%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKE-PGAEEKFKEIAEAYDVLSDPRKREIF 64
            :.||||.|||:|:.|:.::||:||.:.|.:||||.||| |.|..||:|::|||:||||.:||..:
  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126

Human    65 DRYGEE----GLKGSG-PSGGSGG-GANGTSFSYTFHG--DPHAMFAEFFG----GRNPFDTF-- 115
            |.||:.    |.:|.| |.||:|| |..|.|.|:.|..  ||..:|.:.||    ..|.||.|  
  Fly   127 DTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFAD 191

Human   116 ----FGQRNGEEGMDIDDPFSGFPMGMGGFTNVNF---------GRSRSAQEPARKKQDPPVTHD 167
                |||   .:.|.:|..|:....|:....|||.         .:.....:|.|      ..:.
  Fly   192 SKFGFGQ---AQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGR------CQYC 247

Human   168 LRVSLEEIYSG----------CT-KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFP 221
            .....|.:.:|          |. .:..|.:.....:||....:.:.:|:.|..|.:.|..:.. 
  Fly   248 NGTGFETVSTGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRM- 311

Human   222 KEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFK 286
                |..:.   ::....:.:..:.|:|:|:||...|.|||.:|:.|.||.|..        |::
  Fly   312 ----QVGSK---ELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQG--------VYE 361

Human   287 DV---IRPGM----RRKVPGEGLPLPKTPEKR------GDLIIEFEVIFP 323
            |.   :.||.    :..:.|:||       ||      ||..:..::..|
  Fly   362 DQWINVEPGTSSHHKIMLRGKGL-------KRVNAHGHGDHYVHVKITVP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 109/375 (29%)
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 109/374 (29%)
DnaJ 65..127 CDD:278647 34/61 (56%)
DnaJ_zf 227..287 CDD:199908 7/65 (11%)
DnaJ_C 288..409 CDD:199909 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.