DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG3061

DIOPT Version :10

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:167 Identity:60/167 - (35%)
Similarity:82/167 - (49%) Gaps:38/167 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRY 67
            ||||:.||:::.|:|.|||:||::.||:.||||||.|||.|.||.:..|..||:|..||:.:|.|
  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169

Human    68 G-EEGLKGSGPSGGSGGG-----ANGTSFSYTFHGDPHA--MFAEFFGGRNPFDTFFGQRNGEEG 124
            | .|...|.|.:||...|     .|...:|..|..|..|  :|..||.|                
  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNG---------------- 218

Human   125 MDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQD 161
                    |||.     .||:..:.|..|: ||:.::
  Fly   219 --------GFPQ-----QNVHMRQQRRRQQ-AREDRE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ_bact 4..336 CDD:274090 59/166 (36%)
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 50/137 (36%)
DUF1977 264..364 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.