DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG7130

DIOPT Version :10

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster


Alignment Length:73 Identity:46/73 - (63%)
Similarity:59/73 - (80%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFD 65
            ||||||:.||:.|.||.|::|:.|||.|||||||||..|.|||:|:|:..|::||.|..||||:|
  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65

Human    66 RYGEEGLK 73
            ::||||||
  Fly    66 QHGEEGLK 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ_bact 4..336 CDD:274090 43/70 (61%)
CG7130NP_649380.1 DnaJ_bact 4..>73 CDD:274090 41/68 (60%)

Return to query results.
Submit another query.