DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG7387

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster


Alignment Length:395 Identity:79/395 - (20%)
Similarity:147/395 - (37%) Gaps:127/395 - (32%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKD-YYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIF 64
            |.|| ||:.||:.|.|:.::|:.|:...|.|||||........:.|:|::.||::|:|..||..:
  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEY 160

Human    65 DRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDD 129
            |:.|  |:|                       |..| |.|..|  ||.:...     ||....|.
  Fly   161 DQLG--GIK-----------------------DERA-FLEQAG--NPLNVGL-----EEAKKFDS 192

Human   130 PFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISH------- 187
            ..:         ||....:.:|.:            .||.:...|...||.|::::.:       
  Fly   193 DKT---------TNDEINKLKSNE------------FDLPLDFLEATVGCKKRIELRYLRKCETC 236

Human   188 -----------------KRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSN------ 229
                             :|.|..||.:.......::......| |.:.|...:.:..||      
  Fly   237 KGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCK-GKRFTNRNDCETCSNRGFVVS 300

Human   230 ------NIPA-----DIVFVLKDK------------PHNIFKRDGSDVIYPARISLREALCGCTV 271
                  ::|:     |:|.::..:            ..:.|:|.|:|::....:::.||:.|.:.
  Fly   301 NVDVMVSVPSGSRDGDVVNIINPETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSF 365

Human   272 NVPTLDGRTIPVVFKDV---IRPGMRRK----VPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQT 329
            .:..|        ::.|   :.||.:..    :.|:|:   ::.|..|:.|:..:|..|..:...
  Fly   366 QIRGL--------YESVELRVEPGTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVK 419

Human   330 SRTVL 334
            .|.::
  Fly   420 QRQLV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 79/395 (20%)
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 76/390 (19%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 9/63 (14%)
DnaJ_C 298..416 CDD:199909 21/128 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.