DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG12020

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster


Alignment Length:368 Identity:115/368 - (31%)
Similarity:164/368 - (44%) Gaps:88/368 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     4 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAE------------------ 50
            |||..|...|||:.|:|..||||.|:|..|.::|:.  |:.|..:|:                  
  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKD--EQDFVPLAQEGRLTHLSPMGEPRQWAY 69

Human    51 ---AYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGA---NGTSFSYTFHGDPHAMFAEFFGGR 109
               |:|||.:...|.|:||:||.||         ..|.   ||....|.:.||...::...||..
  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGL---------FEGVMLPNGYFPPYQYDGDHMKVYERVFGSY 125

Human   110 NPFDTFFGQRNGEEGMDIDDPFSGFPM-------GMGGFTNVNFGRSRSAQEPARKKQDPPVTHD 167
            :|:            .::.|..|..|.       |:|                .|.| |......
  Fly   126 SPY------------ANVIDAISNPPSLYATRQHGIG----------------VRSK-DASTERI 161

Human   168 LRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDK--ILTIEVKKGWKEGTKITFPKEGDQTSNN 230
            :.:||||:.:||.|.|.:..:.: .|.|..|.|.:  .|.:.:..|...||:..|.:|||:....
  Fly   162 IELSLEEVRTGCVKLMNVWRQEI-VDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPAT 225

Human   231 IPADIVFVLKDKPHNIF-KRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMR 294
            ||.||:|:..||||..| :|:..|::|...|.|.:|..|.|..:.|||.|.:.||..||::||..
  Fly   226 IPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKVVITDVVQPGYT 290

Human   295 RKVPGEGLP-------------LPKTPEKRGDLIIEFEVIFPE 324
            :.||.||||             ..|..|:.|||||||:.|||:
  Fly   291 KVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 115/368 (31%)
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 115/368 (31%)
DnaJ 7..87 CDD:278647 26/81 (32%)
DnaJ_C 156..335 CDD:199909 66/179 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.