DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and mrj

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:361 Identity:90/361 - (24%)
Similarity:126/361 - (34%) Gaps:146/361 - (40%)


- Green bases have known domain annotations that are detailed below.


Human     4 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKE--PGAEEKFKEIAEAYDVLSDPRKREIFD- 65
            |||:.|.::|.|:|.|:|:|||:.||::|||||.:  ..|.::|:|::|||:||||.|||.|:| 
  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67

Human    66 ---------------------RYGEEGLKGSGPSG-------------GSGGGA----------- 85
                                 ||...|..||...|             |||.|.           
  Fly    68 RATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQAFTF 132

Human    86 ----NGTSFSYTFH--------------GD--------------------------------PHA 100
                .||.|...|.              ||                                |..
  Fly   133 RNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYSTHDFDDFDILGGFQFAFRPPEE 197

Human   101 MFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQ----EPARKKQD 161
            :|.||||..:||...|...||..        :|...|..| :..|.|.|.|::    ....|...
  Fly   198 VFREFFGIHSPFADLFRDANGHS--------NGSTSGSSG-SRRNGGSSGSSRHHHHHHQHKVAS 253

Human   162 PPVTHDLRVSLEEIY---SGCTKKMKISHKR--------LNPDGKSIR---------NEDKILTI 206
            |.....|..|:.:.:   ||.|....::|..        .:..|.|::         |..|::| 
  Fly   254 PFGAPMLNYSMMDFFMPTSGFTSFSSMTHGNGSSGVTHISSGPGASVKRTSTSTVFVNGKKLMT- 317

Human   207 EVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDK 242
              |:..:.|.:..|..|.|            |||.|
  Fly   318 --KRVVENGKETVFSYEND------------VLKSK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 90/361 (25%)
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 33/62 (53%)
DnaJ 3..66 CDD:278647 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.