DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DNAJB1 and Tpr2

DIOPT Version :9

Sequence 1:	NP_006136.1	Gene:	DNAJB1 / 3337	HGNCID:	5270	Length:	340	Species:	Homo sapiens
Sequence 2:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster

Alignment Length:	118	Identity:	49/118 - (41%)
Similarity:	63/118 - (53%)	Gaps:	28/118 - (23%)

- Green bases have known domain annotations that are detailed below.

Human     3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEE------KFKEIAEAYDVLSDPRKR 61
            ||||:.||:.|.|||:|||:|||::||.:|||::....|||      ||||:.|||.:|||..|:
  Fly   401 KDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKK 465

Human    62 EIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFF----GGRN 110
            ..:|            ||..........|      ||:.||..||    ||||
  Fly   466 SRYD------------SGQDIEEQEQADF------DPNQMFRTFFQFNGGGRN 500

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DNAJB1	NP_006136.1	DnaJ	1..340	CDD:223560	49/118 (42%)
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	49/118 (42%)
		DnaJ	402..469	CDD:278647	34/66 (52%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910