DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and DnaJ-H

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:404 Identity:116/404 - (28%)
Similarity:170/404 - (42%) Gaps:135/404 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     6 YQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE 70
            |..|.:|..|:|||||:.||:.|..:|||||  |.|.:|||||:.||:|||||.||.|:||||.:
  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69

Human    71 GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFP 135
            ||:         .||.|.|       |....||::|    |||     |...||           
  Fly    70 GLQ---------EGAEGFS-------DASEFFAQWF----PFD-----RVSSEG----------- 98

Human   136 MGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKR----------- 189
                                 |.:::..|...:.::|||||.|..|| |:.:.|           
  Fly    99 ---------------------RGRRNGKVVVKVELTLEEIYVGGMKK-KVEYNRQKLCSKCNGDG 141

Human   190 -------------------------LNP--------DGK--SIRNEDKILTIE------------ 207
                                     |:|        ||:  :||::.|....:            
  Fly   142 GPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRD 206

Human   208 --VKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDV-IYPARISLREALCGC 269
              |::|.....|:.|..||.|.......|::.|:....|.||:|..::: :....|::.|||||.
  Fly   207 LVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGY 271

Human   270 TVNVPTLDG-----RTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPER---- 325
            :.....|||     ||.|   .:|::....:.|.|.|:|:.......|||.::|:|.||:.    
  Fly   272 SHCFKHLDGRNVCLRTYP---GEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFAT 333

Human   326 IPQTSRTVLEQVLP 339
            .||.:  :||.:||
  Fly   334 APQLA--MLEDLLP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 116/404 (29%)
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 116/404 (29%)
DnaJ 5..64 CDD:278647 34/58 (59%)
DnaJ_C 106..329 CDD:199909 55/226 (24%)
DnaJ_zf 134..197 CDD:199908 7/62 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.