DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and l(3)80Fg

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster


Alignment Length:253 Identity:63/253 - (24%)
Similarity:101/253 - (39%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     4 DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYG 68
            |.|..||:.:.|:..||:.||:..|.::||||.|.....|||.:|..||::|:|..:|.||||||
  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94

Human    69 EEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSG 133
            ...:..                .|......::.:..|...:|  |..||||     .||....: 
  Fly    95 VSDINS----------------QYFQKKHDYSEYNRFTLNQN--DDDFGQR-----FDIKQDIA- 135

Human   134 FPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIR 198
            |...:.  ...|:.......:.|:|.......:|.......|.....|.:::    |.|.|.:..
  Fly   136 FYQKLS--ITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVDAFKKILEL----LQPIGINFA 194

Human   199 NEDKILTIEV--KKGWKEGTKITFPKEGD----QTSNNIPADIV-FVLKDKPHNIFKR 249
            ..:.:....|  |.|.:|..::....:..    :..:..|..:| |:.|..|.|:|||
  Fly   195 TVNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDHSFTPQKVVEFIRKKIPFNVFKR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 63/253 (25%)
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 28/63 (44%)
DnaJ 30..91 CDD:278647 25/60 (42%)
TRX_DnaJ 134..244 CDD:239261 17/116 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.