DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG5001

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster


Alignment Length:355 Identity:179/355 - (50%)
Similarity:241/355 - (67%) Gaps:22/355 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFD 65
            ||||||:.|||.:.|:|:|||:|||:.||||||||||...||:||||:||||:||||..|||::|
  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65

Human    66 RYGEEGLKGSGPSGGS-GGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNG---EEGMD 126
            :|||:|||    |||: .||.:..||:|.|||||.|.||:|||..|||.:||...:.   ::..|
  Fly    66 KYGEDGLK----SGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFD 126

Human   127 ID-------DPFSGFPM--GMG-GFTNVNFGRSRSAQEPARK--KQDPPVTHDLRVSLEEIYSGC 179
            :|       .||.|...  |:| ||.......|.:...|.:|  ||||||.|||.|:|||||.||
  Fly   127 LDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGC 191

Human   180 TKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPH 244
            .||||||.:.:..||.| |.|:|.|.|.:|.|||.|||:||.|||||....|||||||:::||||
  Fly   192 VKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPH 255

Human   245 NIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPV-VFKDVIRPGMRRKVPGEGLPLPKTP 308
            .:|||:|||:.|.||::|::||||....|||:.|..:.: ..:::|:|...:::.|.|||.||..
  Fly   256 AMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDT 320

Human   309 EKRGDLIIEFEVIFPERIPQTSRTVLEQVL 338
            .::|||::.|::.|||::....:.||:.:|
  Fly   321 TRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 179/355 (50%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 177/350 (51%)
DnaJ 4..65 CDD:278647 41/60 (68%)
DnaJ_C 174..338 CDD:199909 86/164 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154071
Domainoid 1 1.000 190 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 371 1.000 Inparanoid score I2129
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 1 1.000 - - mtm8440
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1020
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.