DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB1 and CG30156

DIOPT Version :9

Sequence 1:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:260 Identity:63/260 - (24%)
Similarity:98/260 - (37%) Gaps:92/260 - (35%)


- Green bases have known domain annotations that are detailed below.


Human     3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRY 67
            :::|:.|.::..|:..|:||||.:.|||.||||||.||||:.|:.|:||.|.|:|.:||      
  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKR------ 153

Human    68 GEEGLKGSGPSGGSGGGANGTSFSY---TFHGDPH----AMFAEFFGGRNPFDTFFGQRNGEE-G 124
                                  ..|   |..||.|    :.:.::.|     ::.|.:.||.: |
  Fly   154 ----------------------IEYNIATAVGDCHDQDPSQYKDYRG-----ESEFNEANGNDLG 191

Human   125 MDIDDPFSGFPMGMGG---------------------FTNVNF-----------GRSRSAQEPAR 157
            .....|:.|....|..                     |..::|           .|:.||:..:|
  Fly   192 AAFRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSR 256

Human   158 -------------KKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIR-----NEDKIL 204
                         .|.......:|.|.:||:|.. ..|.|...:|...|...:|     |:.|:|
  Fly   257 TNHIAYYMNPTTLSKYTEQQLAELEVEIEEVYIS-DLKHKCRQERSWRDNLFLRARQGNNDQKLL 320

Human   205  204
              Fly   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 63/260 (24%)
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 30/88 (34%)
DUF1977 237..334 CDD:286411 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.