Sequence 1: | NP_006136.1 | Gene: | DNAJB1 / 3337 | HGNCID: | 5270 | Length: | 340 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260752.1 | Gene: | CG30156 / 246488 | FlyBaseID: | FBgn0050156 | Length: | 358 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 63/260 - (24%) |
---|---|---|---|
Similarity: | 98/260 - (37%) | Gaps: | 92/260 - (35%) |
- Green bases have known domain annotations that are detailed below.
Human 3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRY 67
Human 68 GEEGLKGSGPSGGSGGGANGTSFSY---TFHGDPH----AMFAEFFGGRNPFDTFFGQRNGEE-G 124
Human 125 MDIDDPFSGFPMGMGG---------------------FTNVNF-----------GRSRSAQEPAR 157
Human 158 -------------KKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIR-----NEDKIL 204
Human 205 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DNAJB1 | NP_006136.1 | DnaJ | 1..340 | CDD:223560 | 63/260 (24%) |
CG30156 | NP_001260752.1 | DnaJ | 96..157 | CDD:278647 | 30/88 (34%) |
DUF1977 | 237..334 | CDD:286411 | 18/85 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154067 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |