DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and DERL3

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_016884567.1 Gene:DERL3 / 91319 HGNCID:14236 Length:299 Species:Homo sapiens


Alignment Length:114 Identity:29/114 - (25%)
Similarity:55/114 - (48%) Gaps:12/114 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTS-LFVFPISSNTAFH 70
            :..:|..||.:..|.|:.:...:.:::....|:.:...||.|.|:||.:|: ||..|:    .|.
Human    10 FLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPL----GFS 70

  Fly    71 FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYF 119
            |..|..|:.:|...||:..:....||::::.:       .||::..|.|
Human    71 FFFNMLFVFRYCRMLEEGSFRGRTADFVFMFL-------FGGVLMTVSF 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 29/111 (26%)
DERL3XP_016884567.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.