DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and DER1

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_009760.1 Gene:DER1 / 852500 SGDID:S000000405 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:52/218 - (23%)
Similarity:85/218 - (38%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFHF--L 72
            :|..||.|....:|||.|....::....:......||.|.|..|.:.|:|.:     .||::  :
Yeast    12 IPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSIFDY-----GAFNWISM 71

  Fly    73 INCFFIVQYSSKLEKD-QYSRSPADYLYLLIVSAV--------LANIGGMIFNVYFLMDTLVLAI 128
            ||.|....:.|.||.. ...|.....::||:|..|        .|::|            ::|..
Yeast    72 INIFVSANHLSTLENSFNLRRKFCWIIFLLLVILVKMTSIEQPAASLG------------VLLHE 124

  Fly   129 TYIWCQLNKD---VTVSFWFGTRFKAMYLP-WVLAAFEFIFHFSLASLVGIFV-GHVYYFF---- 184
            ..::.:|.|:   :.|.|:..........| ::.|...|::..|...:...|: |||.|:.    
Yeast   125 NLVYYELKKNGNQMNVRFFGAIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGHVIYYMDDII 189

  Fly   185 -KFQYSQDLGGTPL-----LETP 201
             |. |..||..:|.     .|||
Yeast   190 GKI-YGIDLCKSPYDWFRNTETP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 52/218 (24%)
DER1NP_009760.1 Rhomboid 12..>192 CDD:419717 44/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.