DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and DER1

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_194662.2 Gene:DER1 / 829054 AraportID:AT4G29330 Length:266 Species:Arabidopsis thaliana


Alignment Length:272 Identity:77/272 - (28%)
Similarity:120/272 - (44%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GVWYRSLPRFTRYWLTATVVLSMLCRFD--------VIPLHWLHLDRSAVFSKLQLWRCMTSLFV 60
            |.:|.|||..|:.:.|       ||.|.        |.|:| :.|....|..:.|:||.:|:||.
plant     5 GEFYNSLPPITKAYGT-------LCFFTTVATQLGLVAPVH-IALIPELVLKQFQIWRLITNLFF 61

  Fly    61 FPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMI--FNVYFLMDT 123
            .   ...:.:|.|....|.:|..:|||..:.|..||:|:::|..:....:..:|  |...||..:
plant    62 L---GGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFLGVS 123

  Fly   124 LVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFS-LASLVGIFVGHVYYFFKFQ 187
            ||..:.|:|.:...:..:|.:.....||.||||.:.|.:.||... :..|:||..||:|||....
plant   124 LVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGHLYYFLTVL 188

  Fly   188 YSQDLGGTPLLETPQFLKRLV----------------------PDVSGGFGGFGLPPESRAPPRQ 230
            :....|.. .|:||:::.::|                      |...||.||.|....:||||..
plant   189 HPLATGKN-YLKTPKWVNKIVARWRIGAPVASVRQAGGVGAAGPGAGGGVGGGGAYSSARAPPES 252

  Fly   231 ATESPWGRGMTL 242
            :..:..||...|
plant   253 SNTAFRGRSYRL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 59/202 (29%)
DER1NP_194662.2 Rhomboid 11..201 CDD:419717 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11009
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.