DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and DER2.2

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_192395.1 Gene:DER2.2 / 825823 AraportID:AT4G04860 Length:244 Species:Arabidopsis thaliana


Alignment Length:217 Identity:74/217 - (34%)
Similarity:111/217 - (51%) Gaps:16/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFH 70
            ||:.:|..||.:|||.|:.::.|..|:|..:.|:|:.:.|..:.|.||.:|:...|   ......
plant     8 WYKQMPIITRSYLTAAVITTVGCSLDIISPYNLYLNPTLVVKQYQYWRLVTNFLYF---RKMDLD 69

  Fly    71 FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSA-VLAN---IGGMI-------FNVYFLMDTL 124
            |:.:.||:.:|...||::.:....||:||:|:..| ||..   |||||       ..:.||.::|
plant    70 FMFHMFFLARYCKLLEENSFRGKTADFLYMLLFGASVLTGIVLIGGMIPYLSASFAKIIFLSNSL 134

  Fly   125 VLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSL-ASLVGIFVGHVYYFFKFQY 188
            ...:.|:|.:.|..:.:||.....|.|.||||||..|..:...|. ..|:|:..||.|||....|
plant   135 TFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAWVDLLGMIAGHAYYFLAEVY 199

  Fly   189 SQDLGGTPLLETPQFLKRLVPD 210
            .:.....| |:||.|||.|..|
plant   200 PRMTNRRP-LKTPSFLKALFAD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 66/203 (33%)
DER2.2NP_192395.1 Rhomboid 12..212 CDD:419717 66/203 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.