DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and Derl3

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_008772060.1 Gene:Derl3 / 690315 RGDID:1597373 Length:251 Species:Rattus norvegicus


Alignment Length:160 Identity:51/160 - (31%)
Similarity:83/160 - (51%) Gaps:2/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAIT 129
            :.:.:|||..|... :|...||:..:....||::::.:...||..:.|.:.:::||...|:..:.
  Rat    89 AQSTWHFLCQCCRF-RYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSMFFLGQALMAMLV 152

  Fly   130 YIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFS-LASLVGIFVGHVYYFFKFQYSQDLG 193
            |:|.:.:..|.|:|:....|:|.:|||.|..|..:...| :..|:||.|||:|||.:..:....|
  Rat   153 YVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVITDLLGIIVGHIYYFLEDVFPNQPG 217

  Fly   194 GTPLLETPQFLKRLVPDVSGGFGGFGLPPE 223
            |..||.||.|||.|:.|.........||.|
  Rat   218 GKRLLLTPSFLKLLLDDPQEDPNYLPLPEE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 42/137 (31%)
Derl3XP_008772060.1 Rhomboid <102..226 CDD:419717 38/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.