DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and derl2

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001016097.1 Gene:derl2 / 548851 XenbaseID:XB-GENE-5936600 Length:239 Species:Xenopus tropicalis


Alignment Length:239 Identity:74/239 - (30%)
Similarity:122/239 - (51%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTS-LFVFPISSNTAFH 70
            |..:|..||.:.||.|:.:.:.:.::|....|:.:...:|...|:||.:|: ||..|:    .|:
 Frog    10 YMQIPPVTRAYTTACVLTTAVVQLELITPFQLYFNPELIFRHYQIWRLVTNFLFFGPV----GFN 70

  Fly    71 FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQL 135
            ||.|..|:.:|...||:..:....||::::.:...:|..|.|:..|:.||.....:.:.|:|.:.
 Frog    71 FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGLLMVIFGLFVNLVFLGQAFTIMLVYVWSRR 135

  Fly   136 NKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFS-LASLVGIFVGHVYYFFKFQYSQDLGGTPLLE 199
            |..|.::|:....|:|.:|||||..|..:...| :..|:||.|||:|:|.:..:....||..:|:
 Frog   136 NPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGGRILK 200

  Fly   200 TPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGMTLG 243
            ||..||.:. ||......:...||.| |...|    ||.|..||
 Frog   201 TPYILKAIF-DVQEEDPNYNPLPEDR-PGGFA----WGEGQRLG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 58/193 (30%)
derl2NP_001016097.1 DER1 13..203 CDD:335816 58/193 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.