DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and DERL2

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_057125.2 Gene:DERL2 / 51009 HGNCID:17943 Length:239 Species:Homo sapiens


Alignment Length:249 Identity:69/249 - (27%)
Similarity:118/249 - (47%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTS-LFVFPISSNTAFH 70
            |..:|..:|.:.||.|:.:...:.::|....|:.:...:|...|:||.:|: ||..|:    .|:
Human    10 YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPV----GFN 70

  Fly    71 FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQL 135
            ||.|..|:.:|...||:..:....||::::.:....|..:.|:..::.||.....:.:.|:|.:.
Human    71 FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRR 135

  Fly   136 NKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFS-LASLVGIFVGHVYYFFKFQYSQDLGGTPLLE 199
            |..|.::|:....|:|.:|||||..|..:...| :..|:||.|||:|:|.:..:....||..:|:
Human   136 NPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILK 200

  Fly   200 TPQFLKRL--VPDVSGGF--------GGFGLPPESRAPPRQATESPWGRGMTLG 243
            ||..||.:  .||....:        |||.                ||.|..||
Human   201 TPSILKAIFDTPDEDPNYNPLPEERPGGFA----------------WGEGQRLG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 55/193 (28%)
DERL2NP_057125.2 DER1 13..203 CDD:398288 55/193 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..239 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.