DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and SPAC1687.17c

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_593136.2 Gene:SPAC1687.17c / 2542379 PomBaseID:SPAC1687.17c Length:190 Species:Schizosaccharomyces pombe


Alignment Length:180 Identity:40/180 - (22%)
Similarity:76/180 - (42%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTS-LFVFPISSNTAFHFLIN 74
            |..|||.:..|:..::...|..:....:..:.....:|.:.||.:|: |:|.|.    ....::.
pombe    12 PPVTRYIVLGTLFTTLAVNFGYVSDLKIFFNWKLFLAKGEYWRAITTFLYVGPF----GLELILY 72

  Fly    75 CFFIVQYSSKLEKDQYSRSPADYLYLLIV----SAVLANIGGMIFNVYFLMDTLVLAITYIWCQL 135
            ..|::::.|.||:.........:|..:::    ..|.:....|.|...:...|::    |||...
pombe    73 LSFLLRFMSMLERSSPPPQTQSFLKTVLIVWFSLLVTSYFSYMPFAASYFSFTML----YIWSWK 133

  Fly   136 NKDVTVSFWFGTRFKAMYLPWVLAAFEFIFH--FSLASLVGIFVGHVYYF 183
            :....:|.......||.|:|||:....::..  |.|..|:...:||||:|
pombe   134 HPLYRISILGLFDVKAPYVPWVMVLLRWLRTGIFPLLDLISALIGHVYFF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 40/180 (22%)
SPAC1687.17cNP_593136.2 Rhomboid 11..186 CDD:304416 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 1 1.000 - - otm47248
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2482
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.