DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-1 and Derl2

DIOPT Version :9

Sequence 1:NP_001259892.1 Gene:Der-1 / 33369 FlyBaseID:FBgn0267972 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_008766124.1 Gene:Derl2 / 100910823 RGDID:6496100 Length:239 Species:Rattus norvegicus


Alignment Length:249 Identity:68/249 - (27%)
Similarity:118/249 - (47%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTS-LFVFPISSNTAFH 70
            |..:|..:|.:.||.|:.:...:.::|....|:.:...:|...|:||.:|: ||..|:    .|:
  Rat    10 YLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPV----GFN 70

  Fly    71 FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQL 135
            ||.|..|:.:|...||:..:....||::::.:....|..:.|:..::.||.....:.:.|:|.:.
  Rat    71 FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRR 135

  Fly   136 NKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFS-LASLVGIFVGHVYYFFKFQYSQDLGGTPLLE 199
            |..|.::|:....|:|.:|||||..|..:...| :..|:||.|||:|:|.:..:....||..:|:
  Rat   136 NPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDIFPNQPGGIRILK 200

  Fly   200 TPQFLKRL--VPDVSGGF--------GGFGLPPESRAPPRQATESPWGRGMTLG 243
            ||..|:.:  .||....:        |||.                ||.|..||
  Rat   201 TPSILRTIFDTPDEDPNYNPLPEERPGGFA----------------WGEGQRLG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-1NP_001259892.1 DER1 10..202 CDD:282380 55/193 (28%)
Derl2XP_008766124.1 DER1 13..203 CDD:398288 55/193 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.