DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and wds

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:355 Identity:69/355 - (19%)
Similarity:125/355 - (35%) Gaps:130/355 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 ECFVTCSSDDTIRVWGLDGCTNNDIYRRNIYSKELLKIVYSDDELQFIKDQGSSLFDKAGNSSYD 498
            |...:.|:|..|::||                                              :||
  Fly    85 EWLASSSADKLIKIWG----------------------------------------------AYD 103

  Fly   499 G---------RNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEYSNEK 554
            |         :.|:..:..|.:.:.|.||.....::|:.|...:.|.|::.|.:.|.|..::.:.
  Fly   104 GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS 168

  Fly   555 IERKLLASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMISCGADKSIMFRSF 619
               .|:.|.|.|..:.::|| :....|:||..||..::::.|                       
  Fly   169 ---NLIVSGSFDESVRIWDV-RTGKCLKTLPAHSDPVSAVHF----------------------- 206

  Fly   620 QGNIFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKL 684
                     |..|..             |:::..|...|::.|.:.:..||.....:...|.:|.
  Fly   207 ---------NRDGSL-------------IVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF 249

  Fly   685 SLDPSGIYVATSCTDKTLAVYDYYSNECMARMYGHSE---------LVTGLKFTNDCRHLISASG 740
            |  |:|.|:..:..|.||.::||...:|:....||..         .|||.|:      ::|.|.
  Fly   250 S--PNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKW------IVSGSE 306

  Fly   741 DGCIFIWQVPHDMIVTMQARMSQQRLRSGH 770
            |..::||        .:|::...|:|: ||
  Fly   307 DNMVYIW--------NLQSKEVVQKLQ-GH 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 4/13 (31%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 25/148 (17%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 62/330 (19%)
WD40 436..748 CDD:295369 62/329 (19%)
WD40 repeat 505..540 CDD:293791 8/34 (24%)
WD40 repeat 546..586 CDD:293791 10/39 (26%)
WD40 repeat 591..631 CDD:293791 2/39 (5%)
WD40 repeat 637..672 CDD:293791 6/34 (18%)
WD40 repeat 679..717 CDD:293791 12/37 (32%)
WD40 repeat 723..749 CDD:293791 9/25 (36%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 69/355 (19%)
WD40 repeat 75..112 CDD:293791 9/72 (13%)
WD40 repeat 118..154 CDD:293791 8/35 (23%)
WD40 repeat 159..195 CDD:293791 10/39 (26%)
WD40 repeat 202..237 CDD:293791 9/79 (11%)
WD40 repeat 244..280 CDD:293791 12/37 (32%)
WD40 repeat 288..325 CDD:293791 11/50 (22%)
WD40 repeat 331..357 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.