DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and CG7568

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:338 Identity:77/338 - (22%)
Similarity:137/338 - (40%) Gaps:83/338 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 NSSYDGRNGVRCIKIS------------PELQHLASG---------------------------- 518
            |.|:| |:|.||:..|            .:::|:.||                            
  Fly   123 NVSFD-RSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSGNNL 186

  Fly   519 --------DRC------GNIRVYSLVNLRLLTTIEAHESEVLCLEYSNEKIERKLLASASRDRLI 569
                    |:.      |..:|:|..:.:.|.|...|.:|::..|:  ..::.|.:|:||.|...
  Fly   187 TTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEF--HPVDGKSIATASLDGSA 249

  Fly   570 HVFDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMISCGA-DKSIMF---RSFQGNIFMRGTNT 630
            .::||..:: .||.|..|.:.:.:.:|...|   ||:..|: |.|...   ||......:||.:.
  Fly   250 RIYDVETSH-ELQQLTHHGAEVIAARFNRDG---QMLLTGSFDHSAAIWDVRSKSLGHQLRGHSA 310

  Fly   631 SGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVAT 695
            .....:::.    :...|.|...|...|::.|:...|.......||||  ::.:|.|.:|..:||
  Fly   311 ELSNCVWNF----SGSLIATGSLDNTARIWDTRKLDQELYLAARHSDE--VLDVSFDAAGQLLAT 369

  Fly   696 SCTDKTLAVYDYYSN---ECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTM 757
            ..:|.|..|:....:   |.::.|.|||:.|:.:.|:.....|::||.|....:|       :|.
  Fly   370 CSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLW-------LTE 427

  Fly   758 QARMSQQRLRSGH 770
            ..:.||  :.:||
  Fly   428 SGQCSQ--VLAGH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 25/133 (19%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 71/313 (23%)
WD40 436..748 CDD:295369 71/314 (23%)
WD40 repeat 505..540 CDD:293791 11/88 (13%)
WD40 repeat 546..586 CDD:293791 11/39 (28%)
WD40 repeat 591..631 CDD:293791 11/43 (26%)
WD40 repeat 637..672 CDD:293791 6/34 (18%)
WD40 repeat 679..717 CDD:293791 9/40 (23%)
WD40 repeat 723..749 CDD:293791 7/25 (28%)
CG7568NP_001263071.1 WD40 93..466 CDD:225201 77/338 (23%)
WD40 repeat 122..158 CDD:293791 9/35 (26%)
WD40 154..467 CDD:238121 69/306 (23%)
WD40 repeat 189..222 CDD:293791 6/32 (19%)
WD40 repeat 228..265 CDD:293791 11/39 (28%)
WD40 repeat 270..306 CDD:293791 9/38 (24%)
WD40 repeat 314..348 CDD:293791 6/37 (16%)
WD40 repeat 355..393 CDD:293791 9/37 (24%)
WD40 repeat 400..436 CDD:293791 10/44 (23%)
WD40 repeat 442..466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.