| Sequence 1: | NP_001259886.1 | Gene: | Wdr62 / 33367 | FlyBaseID: | FBgn0031374 | Length: | 2397 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001263303.1 | Gene: | WDR38 / 401551 | HGNCID: | 23745 | Length: | 315 | Species: | Homo sapiens |
| Alignment Length: | 307 | Identity: | 67/307 - (21%) |
|---|---|---|---|
| Similarity: | 127/307 - (41%) | Gaps: | 26/307 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 499 GRNG--VRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEYSNEKIERKLLA 561
Fly 562 SASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMISCGADKSIMFRSFQGNIFMR 626
Fly 627 ---GTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDP 688
Fly 689 SGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDM 753
Fly 754 IVTMQARMSQQRLRSGHAPLPRPLAPISPPDGIVLESPTSEIEQPQL 800 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Wdr62 | NP_001259886.1 | WD40 | 73..448 | CDD:295369 | |
| WD40 repeat | 73..107 | CDD:293791 | |||
| WD40 repeat | 113..161 | CDD:293791 | |||
| WD40 | 158..574 | CDD:225201 | 20/76 (26%) | ||
| WD40 repeat | 167..207 | CDD:293791 | |||
| WD40 repeat | 209..285 | CDD:293791 | |||
| WD40 repeat | 254..294 | CDD:293791 | |||
| WD40 repeat | 303..338 | CDD:293791 | |||
| WD40 repeat | 353..407 | CDD:293791 | |||
| WD40 | 385..747 | CDD:225201 | 57/252 (23%) | ||
| WD40 | 436..748 | CDD:295369 | 57/253 (23%) | ||
| WD40 repeat | 505..540 | CDD:293791 | 8/34 (24%) | ||
| WD40 repeat | 546..586 | CDD:293791 | 12/39 (31%) | ||
| WD40 repeat | 591..631 | CDD:293791 | 10/42 (24%) | ||
| WD40 repeat | 637..672 | CDD:293791 | 4/34 (12%) | ||
| WD40 repeat | 679..717 | CDD:293791 | 7/37 (19%) | ||
| WD40 repeat | 723..749 | CDD:293791 | 7/25 (28%) | ||
| WDR38 | NP_001263303.1 | WD40 | <11..299 | CDD:225201 | 66/301 (22%) |
| WD 1 | 19..58 | 10/38 (26%) | |||
| WD40 | 20..301 | CDD:238121 | 65/301 (22%) | ||
| WD40 repeat | 26..61 | CDD:293791 | 8/34 (24%) | ||
| WD 2 | 61..100 | 13/42 (31%) | |||
| WD40 repeat | 67..103 | CDD:293791 | 12/39 (31%) | ||
| WD 3 | 103..142 | 10/40 (25%) | |||
| WD40 repeat | 108..144 | CDD:293791 | 9/37 (24%) | ||
| WD 4 | 145..184 | 6/42 (14%) | |||
| WD40 repeat | 151..189 | CDD:293791 | 4/41 (10%) | ||
| WD 5 | 190..228 | 7/38 (18%) | |||
| WD40 repeat | 195..230 | CDD:293791 | 7/35 (20%) | ||
| WD 6 | 231..272 | 9/48 (19%) | |||
| WD40 repeat | 236..272 | CDD:293791 | 7/43 (16%) | ||
| WD 7 | 275..313 | 7/31 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 295..315 | 1/9 (11%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165143283 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||