Sequence 1: | NP_001259886.1 | Gene: | Wdr62 / 33367 | FlyBaseID: | FBgn0031374 | Length: | 2397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261799.1 | Gene: | Poc1 / 39502 | FlyBaseID: | FBgn0036354 | Length: | 403 | Species: | Drosophila melanogaster |
Alignment Length: | 321 | Identity: | 62/321 - (19%) |
---|---|---|---|
Similarity: | 123/321 - (38%) | Gaps: | 80/321 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 484 QGSSLF-DKAGNSSYDGRN-GVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVL 546
Fly 547 CLEYSNEKIERKLLASASRDRLIHVFD-----VAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMI 606
Fly 607 SCGADKS-----IMFRSF-----QGNIFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYG 661
Fly 662 TQNAKQTKTFKGSHSDE--------GSLIKLSL-------------------------------D 687
Fly 688 PSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQ 748 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Wdr62 | NP_001259886.1 | WD40 | 73..448 | CDD:295369 | |
WD40 repeat | 73..107 | CDD:293791 | |||
WD40 repeat | 113..161 | CDD:293791 | |||
WD40 | 158..574 | CDD:225201 | 20/96 (21%) | ||
WD40 repeat | 167..207 | CDD:293791 | |||
WD40 repeat | 209..285 | CDD:293791 | |||
WD40 repeat | 254..294 | CDD:293791 | |||
WD40 repeat | 303..338 | CDD:293791 | |||
WD40 repeat | 353..407 | CDD:293791 | |||
WD40 | 385..747 | CDD:225201 | 60/318 (19%) | ||
WD40 | 436..748 | CDD:295369 | 60/319 (19%) | ||
WD40 repeat | 505..540 | CDD:293791 | 3/34 (9%) | ||
WD40 repeat | 546..586 | CDD:293791 | 8/44 (18%) | ||
WD40 repeat | 591..631 | CDD:293791 | 12/49 (24%) | ||
WD40 repeat | 637..672 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 679..717 | CDD:293791 | 8/68 (12%) | ||
WD40 repeat | 723..749 | CDD:293791 | 6/26 (23%) | ||
Poc1 | NP_001261799.1 | WD40 | 10..298 | CDD:238121 | 54/309 (17%) |
WD40 | 14..388 | CDD:225201 | 56/307 (18%) | ||
WD40 repeat | 22..58 | CDD:293791 | 3/35 (9%) | ||
WD40 repeat | 63..99 | CDD:293791 | 9/38 (24%) | ||
WD40 repeat | 106..140 | CDD:293791 | 9/35 (26%) | ||
WD40 repeat | 147..183 | CDD:293791 | 11/46 (24%) | ||
WD40 repeat | 189..224 | CDD:293791 | 2/34 (6%) | ||
WD40 repeat | 231..254 | CDD:293791 | 5/22 (23%) | ||
WD40 repeat | 273..297 | CDD:293791 | 4/23 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45442346 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |