DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and Poc1

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster


Alignment Length:321 Identity:62/321 - (19%)
Similarity:123/321 - (38%) Gaps:80/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 QGSSLF-DKAGNSSYDGRN-GVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVL 546
            ||  || |.|....:.|.: |:..::..|:...:|:......:.:::|..........:|.:.|.
  Fly     2 QG--LFRDPALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVN 64

  Fly   547 CLEYSNEKIERKLLASASRDRLIHVFD-----VAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMI 606
            .:.:|.   :..|:|||..||.:.:::     |:..::.      ||.::.|:.|...|  ..|:
  Fly    65 GVAWSP---KGNLVASAGHDRTVKIWEPKLRGVSGEFVA------HSKAVRSVDFDSTG--HLML 118

  Fly   607 SCGADKS-----IMFRSF-----QGNIFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYG 661
            :...|||     :..|.|     |.|.::|....|           .|.|.:.||..|::||:|.
  Fly   119 TASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFS-----------PNGKLVATASDDKSVRIYD 172

  Fly   662 TQNAKQTKTFKGSHSDE--------GSLIKLSL-------------------------------D 687
            ..:.:..:||....:..        |:::.::|                               .
  Fly   173 VDSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFH 237

  Fly   688 PSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQ 748
            |||.::.:...|:|:.:.|......:..:.||::.|..:.|:.|.....:...|..:.:||
  Fly   238 PSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLVWQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 20/96 (21%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 60/318 (19%)
WD40 436..748 CDD:295369 60/319 (19%)
WD40 repeat 505..540 CDD:293791 3/34 (9%)
WD40 repeat 546..586 CDD:293791 8/44 (18%)
WD40 repeat 591..631 CDD:293791 12/49 (24%)
WD40 repeat 637..672 CDD:293791 9/34 (26%)
WD40 repeat 679..717 CDD:293791 8/68 (12%)
WD40 repeat 723..749 CDD:293791 6/26 (23%)
Poc1NP_001261799.1 WD40 10..298 CDD:238121 54/309 (17%)
WD40 14..388 CDD:225201 56/307 (18%)
WD40 repeat 22..58 CDD:293791 3/35 (9%)
WD40 repeat 63..99 CDD:293791 9/38 (24%)
WD40 repeat 106..140 CDD:293791 9/35 (26%)
WD40 repeat 147..183 CDD:293791 11/46 (24%)
WD40 repeat 189..224 CDD:293791 2/34 (6%)
WD40 repeat 231..254 CDD:293791 5/22 (23%)
WD40 repeat 273..297 CDD:293791 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.