DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and wdr21

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_956995.1 Gene:wdr21 / 393674 ZFINID:ZDB-GENE-040109-2 Length:505 Species:Danio rerio


Alignment Length:464 Identity:89/464 - (19%)
Similarity:158/464 - (34%) Gaps:120/464 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SNKISSKVAAVCFSEDGSYFVTVGNRHVKYWYLEGGRKYKDPIPLMG---------RSAILGD-- 255
            |:..||...:......|.||....||   |:.|..|....:|:...|         |||:|.:  
Zfish    46 SSSASSSAPSSAPELPGFYFDPEKNR---YFRLLPGHNNCNPLTKEGLQKKEEEKKRSALLAEDD 107

  Fly   256 ------LRDNDFCAVACGK---GICAESTYA--------ITRQGHLVEFSSRRLLDKWVQCRTTN 303
                  .|.....|:...|   |:...|:|:        ...|.|.:|..|         ..:|:
Zfish   108 GPKKKSPRTGLNSALLLQKRHLGLLPPSSYSRLIHELKVSGMQRHRLEVQS---------SNSTS 163

  Fly   304 ANCICVNERFILVGCAESIIRIFNSATLEYVTTLPRTHYLGVDVAQGIQINHIMSVPQQAKFPDC 368
            .|    .:.|.|:....:..|:|   |:.             ||:.|.....||:      |..|
Zfish   164 PN----TDNFHLIVADSACERVF---TVN-------------DVSHGGCKYGIMN------FHGC 202

  Fly   369 IAMVFDEQRSKVSCVYNDHSLYIWDLRDISRV---GKSHSFLYHSTCIWGVETVPYNVEREPSQT 430
                   ::..:|....| :||..: |.::.|   ..:|:..:...|:.|:...|..|...|:..
Zfish   203 -------RKGSLSVEMCD-NLYFTN-RKVNSVCWASVTHTDSHVLLCLVGISQTPGCVSLLPASL 258

  Fly   431 L----PEECFVTCSSDDTIRVWGLDGCTN--------NDIYRRNIYSKELL--KIVY-SDDEL-- 478
            .    |::..:.||...: ..|....|.|        ..:.||.|.:..:.  :..| :|.::  
Zfish   259 FSNFNPDQPGMLCSFKIS-TAWSCAWCLNPQADKTFSTGLSRRVIVTDAVTGRRATYLADSDVLA 322

  Fly   479 -QFI----------------------KDQGSSLFDKAGNSSYDGRNGVRCIKISPELQHLASGDR 520
             ||.                      :|:|...|.....|.:...:.:..:::..:..:|.:.|.
Zfish   323 QQFALRAPVLFNGCRSGEIFSIDLRQRDRGRMGFHGWKTSRFYQESAITSVQLLQDENYLLAADM 387

  Fly   521 CGNIRVYSLVNLRLLTTIEAHESEVLCLEYSNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLD 585
            .|.|:::.:...|.:...|.|.:|...|.....:.|..||| ..:|....::.:..:.||.....
Zfish   388 LGKIKLWDIRVKRCVKQYEGHHNEYAYLPIHINEPEGLLLA-VGQDCYTRLWSLQDSRLLRTIPS 451

  Fly   586 DHSSSITSI 594
            .|.:...||
Zfish   452 PHPAGKDSI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 56/280 (20%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 84/442 (19%)
WD40 repeat 167..207 CDD:293791 1/4 (25%)
WD40 repeat 209..285 CDD:293791 22/103 (21%)
WD40 repeat 254..294 CDD:293791 10/58 (17%)
WD40 repeat 303..338 CDD:293791 6/34 (18%)
WD40 repeat 353..407 CDD:293791 11/56 (20%)
WD40 385..747 CDD:225201 47/253 (19%)
WD40 436..748 CDD:295369 35/195 (18%)
WD40 repeat 505..540 CDD:293791 5/34 (15%)
WD40 repeat 546..586 CDD:293791 8/39 (21%)
WD40 repeat 591..631 CDD:293791 2/4 (50%)
WD40 repeat 637..672 CDD:293791
WD40 repeat 679..717 CDD:293791
WD40 repeat 723..749 CDD:293791
wdr21NP_956995.1 WD40 119..474 CDD:225201 71/388 (18%)
WD40 repeat 278..315 CDD:293791 6/36 (17%)
WD40 repeat 321..363 CDD:293791 5/41 (12%)
WD40 <367..>467 CDD:295369 19/95 (20%)
WD40 repeat 370..406 CDD:293791 5/35 (14%)
WD40 repeat 414..450 CDD:293791 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.