DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and Poc1b

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_082016.1 Gene:Poc1b / 382406 MGIID:1918511 Length:476 Species:Mus musculus


Alignment Length:516 Identity:96/516 - (18%)
Similarity:173/516 - (33%) Gaps:167/516 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQT 430
            |:|         .:::....|..|.:|.|:..:|   ::.::.|...:..::..|..        
Mouse    28 PNC---------KQIATASWDTFLMLWSLKPHAR---AYRYVGHKDVVTSLQFSPQG-------- 72

  Fly   431 LPEECFVTCSSDDTIRVWGLDGCTNNDIYRRNIYSKELLKIVYSDDELQFIKDQGSSLFDKAGNS 495
               ....:.|.|.|:|:|.||                               .:|.|...||..:
Mouse    73 ---NLLASASRDRTVRLWVLD-------------------------------RKGKSSEFKAHTA 103

  Fly   496 SYDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEYSNEKIERKLL 560
            .      ||.:..|.:.|.|.:.....:|:|:|:...|.|.::..|...|.|.::|.   :.:|:
Mouse   104 P------VRSVDFSADGQLLVTASEDKSIKVWSMFRQRFLYSLYRHTHWVRCAKFSP---DGRLI 159

  Fly   561 ASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMI-SCGADKSIMFRSFQGNIF 624
            .|.|.|:.|.::|....    |.:::.|.|:....||....|...| |.|:|.::          
Mouse   160 VSCSEDKTIKIWDTTNK----QCVNNFSDSVGFANFVDFNPNGTCIASAGSDHAV---------- 210

  Fly   625 MRGTNTSGKTTLYDMEVDSNAKHI-LTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDP 688
                      .::|:.::...:|. :.:|                           .:..||..|
Mouse   211 ----------KIWDIRMNKLLQHYQVHSC---------------------------GVNCLSFHP 238

  Fly   689 SGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDM 753
            .|..:.|:.:|.|:.:.|......:..:.||:..|..:.|:.|...|.|...|..:.||:.....
Mouse   239 LGNSLVTASSDGTVKMLDLIEGRLIYTLQGHTGPVFTVSFSKDGELLTSGGADAQVLIWRTNFIH 303

  Fly   754 IVTMQARMSQQRL-------------RSGHAPLPR-------------PLAPISPP--DGIVLES 790
            :.....:.:.:||             ||.|:...|             .|...|||  |.:..:|
Mouse   304 LHCKDPKRNLKRLHFEASPHLLDIYPRSPHSHEDRKETIEINPKREVMDLQSSSPPVVDVLSFDS 368

  Fly   791 PTSE-----------------IEQPQLQPKFG---VAERFSDVGQLPQWAMRK---AAADS 828
            .|..                 ...|.|.|:..   |.:|..||..:|..::|.   |.||:
Mouse   369 TTMTDSTYRAVPGKGEDICRYFLNPLLMPECSSTTVKKRPEDVSDVPSESLRSVPLAVADA 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 13/81 (16%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 39/207 (19%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791 7/40 (18%)
WD40 385..747 CDD:225201 67/363 (18%)
WD40 436..748 CDD:295369 61/313 (19%)
WD40 repeat 505..540 CDD:293791 8/34 (24%)
WD40 repeat 546..586 CDD:293791 9/39 (23%)
WD40 repeat 591..631 CDD:293791 7/40 (18%)
WD40 repeat 637..672 CDD:293791 3/35 (9%)
WD40 repeat 679..717 CDD:293791 8/37 (22%)
WD40 repeat 723..749 CDD:293791 8/25 (32%)
Poc1bNP_082016.1 WD40 10..298 CDD:238121 70/383 (18%)
WD40 14..>300 CDD:225201 71/385 (18%)
WD 1 16..55 7/38 (18%)
WD40 repeat 21..58 CDD:293791 7/41 (17%)
WD 2 58..97 11/80 (14%)
WD40 repeat 63..100 CDD:293791 10/78 (13%)
WD 3 100..139 11/44 (25%)
WD40 repeat 106..142 CDD:293791 9/35 (26%)
WD 4 142..181 11/45 (24%)
WD40 repeat 147..182 CDD:293791 10/41 (24%)
WD 5 183..223 10/59 (17%)
WD40 repeat 190..225 CDD:293791 9/54 (17%)
WD 6 226..265 9/65 (14%)
WD40 repeat 231..267 CDD:293791 8/35 (23%)
WD 7 268..307 10/38 (26%)
WD40 repeat 273..299 CDD:293791 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.