DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr62 and CG10931

DIOPT Version :9

Sequence 1:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster
Sequence 2:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster


Alignment Length:395 Identity:83/395 - (21%)
Similarity:127/395 - (32%) Gaps:169/395 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 HSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGL-------------DGCTN 455
            ||.|.||.|:.|::.           :...|..|:.|.|..:::|.|             ||.  
  Fly    50 HSLLGHSGCVTGLKF-----------SSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGV-- 101

  Fly   456 NDIYRRNIYSKELLKIVYSDDELQFIKDQGSSLFDKAGNSSYDGRNGVRCIKISPELQHLASGDR 520
            ||:    .:|...|....|||....:.|..|.|                |:|:            
  Fly   102 NDV----AWSAAGLIASCSDDMTVRLWDARSKL----------------CVKV------------ 134

  Fly   521 CGNIRVYSLVNLRLLTTIEAHESEVLCLEYSNE---KIERKLLASASRDRLIHVFDVAQNYLLLQ 582
                             :|.|.      .||..   ..:..||||.|.|..:.::|| :....|:
  Fly   135 -----------------LEGHS------RYSFSCCFNPQANLLASTSFDETVRLWDV-RTGKTLK 175

  Fly   583 TLDDHSSSITSIKFVGAGLNFQMISCGADKSIMFRSFQGNIFMRGTNTSGKTTLYDMEV---DSN 644
            .:..|...|||:.|                     ...||||:        |:.||..|   ||:
  Fly   176 IVHAHQDPITSVDF---------------------HRDGNIFV--------TSSYDGLVRLWDSS 211

  Fly   645 AKHILTACQD-RNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKTLAVYDYY 708
            ..|:|....| .|:.|                    ..:|.|  |:|.|:.:|..:.||.:::|.
  Fly   212 TGHVLKTLVDVDNIPV--------------------GYVKFS--PNGRYILSSTLNNTLRLWNYK 254

  Fly   709 SNECMARMYGHSELVTGLKFTND--CRH----------LISASGDGCIFIWQVPHDMIVTMQARM 761
            ..:||....||         .|:  |.:          ::|.|.|..:.||        .:|.|.
  Fly   255 KPKCMRTYRGH---------LNEFYCSNSNFSTTGGIWIVSGSEDNTLCIW--------NLQTRE 302

  Fly   762 SQQRL 766
            ..|::
  Fly   303 LVQKI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr62NP_001259886.1 WD40 73..448 CDD:295369 11/43 (26%)
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201 37/185 (20%)
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791 2/2 (100%)
WD40 385..747 CDD:225201 78/374 (21%)
WD40 436..748 CDD:295369 71/343 (21%)
WD40 repeat 505..540 CDD:293791 2/34 (6%)
WD40 repeat 546..586 CDD:293791 11/42 (26%)
WD40 repeat 591..631 CDD:293791 8/39 (21%)
WD40 repeat 637..672 CDD:293791 10/38 (26%)
WD40 repeat 679..717 CDD:293791 11/37 (30%)
WD40 repeat 723..749 CDD:293791 7/37 (19%)
CG10931NP_611261.1 WD40 <48..341 CDD:225201 83/395 (21%)
WD40 49..341 CDD:238121 83/395 (21%)
WD40 repeat 59..96 CDD:293791 7/47 (15%)
WD40 repeat 102..137 CDD:293791 12/83 (14%)
WD40 repeat 142..178 CDD:293791 10/36 (28%)
WD40 repeat 185..220 CDD:293791 15/63 (24%)
WD40 repeat 227..263 CDD:293791 12/57 (21%)
WD40 repeat 271..309 CDD:293791 9/45 (20%)
WD40 repeat 314..340 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.