| Sequence 1: | NP_001259886.1 | Gene: | Wdr62 / 33367 | FlyBaseID: | FBgn0031374 | Length: | 2397 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246361.1 | Gene: | Lis-1 / 36791 | FlyBaseID: | FBgn0015754 | Length: | 411 | Species: | Drosophila melanogaster |
| Alignment Length: | 269 | Identity: | 63/269 - (23%) |
|---|---|---|---|
| Similarity: | 113/269 - (42%) | Gaps: | 27/269 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 500 RNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEYSNEKIERKLLASAS 564
Fly 565 RDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGAGLNFQMISCGADKSI-MFRSFQGNIFMRGT 628
Fly 629 NTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPS---- 689
Fly 690 --------------GIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASG 740
Fly 741 DGCIFIWQV 749 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Wdr62 | NP_001259886.1 | WD40 | 73..448 | CDD:295369 | |
| WD40 repeat | 73..107 | CDD:293791 | |||
| WD40 repeat | 113..161 | CDD:293791 | |||
| WD40 | 158..574 | CDD:225201 | 15/73 (21%) | ||
| WD40 repeat | 167..207 | CDD:293791 | |||
| WD40 repeat | 209..285 | CDD:293791 | |||
| WD40 repeat | 254..294 | CDD:293791 | |||
| WD40 repeat | 303..338 | CDD:293791 | |||
| WD40 repeat | 353..407 | CDD:293791 | |||
| WD40 | 385..747 | CDD:225201 | 62/265 (23%) | ||
| WD40 | 436..748 | CDD:295369 | 62/266 (23%) | ||
| WD40 repeat | 505..540 | CDD:293791 | 4/34 (12%) | ||
| WD40 repeat | 546..586 | CDD:293791 | 12/39 (31%) | ||
| WD40 repeat | 591..631 | CDD:293791 | 11/40 (28%) | ||
| WD40 repeat | 637..672 | CDD:293791 | 9/34 (26%) | ||
| WD40 repeat | 679..717 | CDD:293791 | 8/55 (15%) | ||
| WD40 repeat | 723..749 | CDD:293791 | 11/25 (44%) | ||
| Lis-1 | NP_001246361.1 | LisH | 9..40 | CDD:128913 | |
| WD40 | 100..409 | CDD:238121 | 63/269 (23%) | ||
| WD40 repeat | 111..148 | CDD:293791 | 4/36 (11%) | ||
| WD40 repeat | 154..191 | CDD:293791 | 12/39 (31%) | ||
| WD40 repeat | 196..232 | CDD:293791 | 11/39 (28%) | ||
| WD40 repeat | 239..274 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 280..336 | CDD:293791 | 8/55 (15%) | ||
| WD40 repeat | 342..378 | CDD:293791 | 11/27 (41%) | ||
| WD40 repeat | 384..408 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45442358 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||